Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FZR1/CDH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | FZR1/CDH1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15697620
|
Novus Biologicals
NBP15697620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156976
|
Novus Biologicals
NBP156976 |
100 μL |
Each for $487.50
|
|
|||||
Description
FZR1/CDH1 Polyclonal specifically detects FZR1/CDH1 in Human samples. It is validated for Western Blot.Specifications
| FZR1/CDH1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| CDC20C, CDH1, Cdh1/Hct1 homolog, CDH1CDC20-like 1b, fizzy/cell division cycle 20 related 1 (Drosophila), Fzr, FZR2, FZRCDC20-like protein 1, hCDH1, HCDHFYR, KIAA1242fizzy-related protein homolog | |
| FZR1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UM11 | |
| 51343 | |
| Synthetic peptides corresponding to FZR1/CDH1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of FZR1/CDH1. Peptide sequence SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title