Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G-substrate Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179480
Description
G-substrate Polyclonal specifically detects G-substrate in Human samples. It is validated for Western Blot.Specifications
| G-substrate | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 7 open reading frame 16, GSBSG-substrate | |
| Rabbit | |
| 18 kDa | |
| 100 μL | |
| Signal Transduction | |
| 10842 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_006649 | |
| PPP1R17 | |
| Synthetic peptide directed towards the middle region of human C7orf16. Peptide sequence IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH. | |
| Affinity purified | |
| RUO | |
| Primary | |
| This product recognizes Human. Predicted Homology Based On Immunogen Sequence: Rabbit: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction