Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G-substrate Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | G-substrate |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
G-substrate Polyclonal specifically detects G-substrate in Human samples. It is validated for Western Blot.Specifications
G-substrate | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
chromosome 7 open reading frame 16, GSBSG-substrate | |
PPP1R17 | |
IgG | |
18 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_006649 | |
10842 | |
Synthetic peptide directed towards the middle region of human C7orf16. Peptide sequence IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title