Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G2E3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | G2E3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155281
|
Novus Biologicals
NBP155281 |
100 μL |
Each for $487.50
|
|
|||||
|
NB15739520
|
Novus Biologicals
NBP15528120UL |
20 μL | N/A | N/A | N/A | ||||
Description
G2E3 Polyclonal specifically detects G2E3 in Human samples. It is validated for Western Blot.Specifications
| G2E3 | |
| Polyclonal | |
| Rabbit | |
| Q7L622 | |
| 55632 | |
| Synthetic peptides corresponding to KIAA1333(KIAA1333) The peptide sequence was selected from the N terminal of KIAA1333. Peptide sequence IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 6.3.2, EC 6.3.2.-, FLJ20333, G2/M phase-specific E3 ubiquitin-protein ligase, G2/M-phase specific E3 ubiquitin ligase, G2/M-phase specific E3 ubiquitin protein ligase, KIAA1333PHD finger protein 7B, PHF7B | |
| G2E3 | |
| IgG | |
| 80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title