Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GJD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	GJD3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15916020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15916020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159160 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159160	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GJD3 Polyclonal specifically detects GJD3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	GJD3
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	Connexin-31.9, Cx30.2, Cx31.9, CX31.9connexin-31.9, Gap junction alpha-11 protein, Gap junction chi-1 protein, gap junction protein, chi 1, 31.9kDa, gap junction protein, delta 3, 31.9kDa, GJA11connexin 31.9, GJC1gap junction delta-3 protein
Gene Symbols	GJD3
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	Q6ZUW6
Gene ID (Entrez)	125111
Immunogen	Synthetic peptides corresponding to GJC1 (gap junction protein, chi 1, 31.9kDa) The peptide sequence was selected from the N terminal of GJC1. Peptide sequence IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GJD3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents