Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GJD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | GJD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15916020
|
Novus Biologicals
NBP15916020UL |
20 μL |
Each for $152.22
|
|
NBP159160
|
Novus Biologicals
NBP159160 |
100 μL |
Each for $436.00
|
|
Description
GJD3 Polyclonal specifically detects GJD3 in Human samples. It is validated for Western Blot.Specifications
| GJD3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q6ZUW6 | |
| 125111 | |
| Synthetic peptides corresponding to GJC1 (gap junction protein, chi 1, 31.9kDa) The peptide sequence was selected from the N terminal of GJC1. Peptide sequence IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Connexin-31.9, Cx30.2, Cx31.9, CX31.9connexin-31.9, Gap junction alpha-11 protein, Gap junction chi-1 protein, gap junction protein, chi 1, 31.9kDa, gap junction protein, delta 3, 31.9kDa, GJA11connexin 31.9, GJC1gap junction delta-3 protein | |
| GJD3 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title