Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLT6D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | GLT6D1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17931020
![]() |
Novus Biologicals
NBP17931020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179310
![]() |
Novus Biologicals
NBP179310 |
100 μL |
Each for $487.50
|
|
|||||
Description
GLT6D1 Polyclonal specifically detects GLT6D1 in Human samples. It is validated for Western Blot.Specifications
GLT6D1 | |
Polyclonal | |
Rabbit | |
NP_892019 | |
360203 | |
Synthetic peptide directed towards the middle region of human GLT6D1The immunogen for this antibody is GLT6D1. Peptide sequence FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
galactosyltransferase family 6 domain containing 1, galactosyltransferase family 6 domain-containing 1, glycosyltransferase 6 domain containing 1, glycosyltransferase 6 domain-containing protein 1, GT6M7 | |
GLT6D1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title