Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GRK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	GRK4
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15531320 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15531320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155313 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155313	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GRK4 Polyclonal specifically detects GRK4 in Human samples. It is validated for Western Blot.

Specifications

Antigen	GRK4
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Protein Kinase
Gene Alias	EC 2.7.11, EC 2.7.11.16, G protein-coupled receptor kinase 2-like (Drosophila), G protein-coupled receptor kinase 4, G protein-coupled receptor kinase GRK4, GPRK2LIT11, GPRK4GRK4a, G-protein coupled receptor kinase 4, ITI1
Gene Symbols	GRK4
Isotype	IgG
Molecular Weight of Antigen	59 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P32298
Gene ID (Entrez)	2868
Immunogen	Synthetic peptides corresponding to GRK4(G protein-coupled receptor kinase 4) The peptide sequence was selected from the middle region of GRK4. Peptide sequence QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GRK4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents