Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GTF3C5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

GTF3C5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7233235 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125653 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125653 Supplier Novus Biologicals Supplier No. NBP310376100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GTF3C5 Polyclonal specifically detects GTF3C5 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen GTF3C5
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS buffer, 2% sucrose
Gene Alias FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GTF3C5 (NP_036219). Peptide sequence KVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNP
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9328
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.