Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Guanylyl Cyclase alpha 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB124365 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB124365 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB124365 Supplier Novus Biologicals Supplier No. NBP309732100UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Guanylyl Cyclase alpha 2 Polyclonal specifically detects Guanylyl Cyclase alpha 2 in Human samples. It is validated for Western Blot.

Specifications

Antigen Guanylyl Cyclase alpha 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias EC 4.6.1.2, GC-SA2, GCS-alpha-2, guanylate cyclase 1, soluble, alpha 2, GUC1A2guanylate cyclase soluble subunit alpha-2, GUCSA2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human Guanylyl Cyclase alpha 2 (NP_001243353). Peptide sequence KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2977
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.