Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HA95/AKAP8L Antibody, Novus Biologicals™
SDP

Catalog No. NBP247441 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP247441 0.1 mL
NB404521 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP247441 Supplier Novus Biologicals Supplier No. NBP247441
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

HA95/AKAP8L Polyclonal specifically detects HA95/AKAP8L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen HA95/AKAP8L
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias A kinase (PRKA) anchor protein 8-like, AKAP8-like protein, HA95, HAP95 DKFZp434L0650, helicase A-binding protein 95 kDa, Homologous to AKAP95 protein, HRIHFB2018, NAKAP, NAKAP95 A-kinase anchor protein 8-like, neighbor of A kinase anchoring protein 95, Neighbor of AKAP95, Neighbor of A-kinase-anchoring protein 95
Gene Symbols AKAP8L
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FLQEYVTNKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRR
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 26993
Test Specificity Specificity of HA95/AKAP8L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.