Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HGFR/c-MET Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | HGFR/c-MET |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HGFR/c-MET Polyclonal specifically detects HGFR/c-MET in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| HGFR/c-MET | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cancer Stem Cells, Cell Cycle and Replication, Cellular Markers, Oncogenes, Protein Kinase, Signal Transduction, Tyrosine Kinases | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4233 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP2, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met | |
| MET | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title