Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
hHR23b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18969825UL
Description
hHR23b Polyclonal specifically detects hHR23b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
hHR23b | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20 | |
HHR23B, HR23BUV excision repair protein RAD23 homolog B, p58, RAD23 (S. cerevisiae) homolog B, RAD23 homolog B (S. cerevisiae), RAD23, yeast homolog of, B, XP-C repair complementing complex 58 kDa, XP-C repair complementing protein, XP-C repair-complementing complex 58 kDa protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
RAD23B | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQE | |
25 μL | |
Apoptosis, Cancer, Core ESC Like Genes, DNA Repair, Nucleotide Excision Repair, Stem Cell Markers, Tumor Suppressors | |
5887 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction