hHR23b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189698

Catalog No. NBP189698

Description

hHR23b Polyclonal specifically detects hHR23b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: hHR23b
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: HHR23B, HR23BUV excision repair protein RAD23 homolog B, p58, RAD23 (S. cerevisiae) homolog B, RAD23 homolog B (S. cerevisiae), RAD23, yeast homolog of, B, XP-C repair complementing complex 58 kDa, XP-C repair complementing protein, XP-C repair-complementing complex 58 kDa protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RAD23B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQE
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cancer, Core ESC Like Genes, DNA Repair, Nucleotide Excision Repair, Stem Cell Markers, Tumor Suppressors
• Gene ID (Entrez): 5887
• Target Species: Human
• Isotype: IgG

For Research Use Only