Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

hHR23b Antibody, Novus Biologicals™
SDP

Catalog No. p-200044308 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB405839 25 μL
NBP189698 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB405839 Supplier Novus Biologicals Supplier No. NBP18969825UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

hHR23b Polyclonal specifically detects hHR23b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen hHR23b
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias HHR23B, HR23BUV excision repair protein RAD23 homolog B, p58, RAD23 (S. cerevisiae) homolog B, RAD23 homolog B (S. cerevisiae), RAD23, yeast homolog of, B, XP-C repair complementing complex 58 kDa, XP-C repair complementing protein, XP-C repair-complementing complex 58 kDa protein
Gene Symbols RAD23B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Core ESC Like Genes, DNA Repair, Nucleotide Excision Repair, Stem Cell Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 5887
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.