Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP241341

HIV-1 Gag p24 Antibody (7F4), HRP, Novus Biologicals™
SDP

Catalog No. NBP241341 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP241341 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP241341 Supplier Novus Biologicals Supplier No. NBP241341
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.

Specifications

Antigen HIV-1 Gag p24
Applications Western Blot, ELISA
Classification Monoclonal
Clone 7F4
Concentration 1 mg/mL
Conjugate HRP
Dilution Western Blot 0.2 - 0.5 μg/mL, ELISA 0.2 - 0.5 μg/mL
Formulation Antibody is supplied in PBS containing 1% BSA and 0.02% thimerosol. with 0.02% Thimerosal
Gene Alias Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
Gene Symbols gag
Host Species Mouse
Immunogen Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Molecular Weight of Antigen 24, 41, 55 kDa
Purification Method Affinity Purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 155030
Test Specificity By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.
Target Species Virus
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.