Learn More
Description
Specifications
Specifications
| Antigen | HIV-1 Gag p24 |
| Applications | Western Blot, ELISA |
| Classification | Polyclonal |
| Conjugate | mFluor Violet 610 SE |
| Dilution | Western Blot, ELISA |
| Formulation | 50mM Sodium Borate |
| Host Species | Rabbit |
| Immunogen | Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla |
| Purification Method | Peptide affinity purified |
| Quantity | 0.1 mL |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
