Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HLA DQA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | HLA DQA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15699320
|
Novus Biologicals
NBP15699320UL |
20 μL |
Each for $152.22
|
|
NBP156993
|
Novus Biologicals
NBP156993 |
100 μL |
Each for $436.00
|
|
Description
HLA DQA2 Polyclonal specifically detects HLA DQA2 in Human samples. It is validated for Western Blot.Specifications
| HLA DQA2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DX alpha chain, DX-ALPHA, HLA class II histocompatibility antigen, DQ alpha 2 chain, HLA class II histocompatibility antigen, DQ(6) alpha chain, HLA-DQA1, HLA-DXAMHC class II DQA2, major histocompatibility complex, class II, DQ alpha 2 | |
| HLA-DQA2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P01906 | |
| 3118 | |
| Synthetic peptides corresponding to HLA-DQA2 (major histocompatibility complex, class II, DQ alpha 2) The peptide sequence was selected from the middle region of HLA-DQA2. Peptide sequence LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title