Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXA13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$366.50 - $607.50
Specifications
Antigen | HOXA13 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin |
Applications | Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
HOXA13 Polyclonal antibody specifically detects HOXA13 in Human samples. It is validated for Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
HOXA13 | |
Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cell Biology | |
PBS, pH 7.2, 40% glycerol | |
3209 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin | |
Polyclonal | |
Purified | |
RUO | |
Human | |
homeo box 1J, homeo box A13, homeobox A13, Homeobox protein Hox-1J, homeobox protein HOXA13, HOX1, HOX1Jhomeobox protein Hox-A13, transcription factor HOXA13 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title