HOXB7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NBP21409825UL

Catalog No. NB438088

Description

HOXB7 Polyclonal specifically detects HOXB7 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HOXB7
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: HHO.C1, homeo box 2C, homeo box B7, homeo box c1 protein, homeobox B7, Homeobox protein HHO.C1, Homeobox protein Hox-2C, homeobox protein Hox-B7, HOX2, HOX2CHox-2.3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3217
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HOXB7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only