Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSFY1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | HSFY1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HSFY1 Polyclonal specifically detects HSFY1 in Human samples. It is validated for Western Blot.Specifications
HSFY1 | |
Polyclonal | |
Rabbit | |
NP_149099 | |
86614 | |
Synthetic peptide directed towards the N terminal of human HSFY1. Peptide sequence MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPGDSDLRSMIEEHAFQV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ25453, Heat shock transcription factor 2-like protein, heat shock transcription factor, Y linked 2, heat shock transcription factor, Y-linked, HSF2L, HSF2-like, HSFY, HSFY1 | |
HSFY1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title