Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HspB7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | HspB7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16907220
|
Novus Biologicals
NBP16907220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169072
|
Novus Biologicals
NBP169072 |
100 μL |
Each for $487.50
|
|
|||||
Description
HspB7 Polyclonal specifically detects HspB7 in Mouse samples. It is validated for Western Blot.Specifications
| HspB7 | |
| Polyclonal | |
| Rabbit | |
| P35385 | |
| 27129 | |
| Synthetic peptides corresponding to Hspb7 (heat shock protein family, member 7 (cardiovascular)) The peptide sequence was selected from the middle region of Hspb7. Peptide sequence FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Cardiovascular heat shock protein, CVHSP, DKFZp779D0968, FLJ32733, heat shock 27kDa protein family, member 7 (cardiovascular), heat shock protein beta-7, HspB7, member 7 (cardiovascular) | |
| HSPB7 | |
| IgG | |
| 19 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title