Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IF3EI Antibody, Novus Biologicals™

IF3EI Antibody, Novus Biologicals™
SDP

Catalog No. NBP156926 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156926 100 μL
NBP15692620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP156926 Supplier Novus Biologicals Supplier No. NBP156926
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

IF3EI Polyclonal specifically detects IF3EI in Human samples. It is validated for Western Blot.

Specifications

Antigen IF3EI
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y262
Gene Alias eIEF associated protein HSPC021, EIF3EIP, eIF3l, EIF3S11, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein, eukaryotic translation initiation factor 3 subunit L, eukaryotic translation initiation factor 3, subunit 6 interacting protein, eukaryotic translation initiation factor 3, subunit L, HSPC021, HSPC025, MSTP005, subunit E interacting protein
Gene Symbols EIF3L
Host Species Rabbit
Immunogen Synthetic peptides corresponding to EIF3EIP(eukaryotic translation initiation factor 3, subunit E interacting protein) The peptide sequence was selected from the N terminal of EIF3EIP. Peptide sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 51386
Test Specificity This product is specific to Subunit or Isoform: L.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.