IFIT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23250025UL

Catalog No. NB437032

Description

IFIT3 Polyclonal specifically detects IFIT3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IFIT3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CIG-49, GARG-49, IFI60Retinoic acid-induced gene G protein, IFIT-3, IFIT-4, IFIT4IFI-60K, interferon-induced protein with tetratricopeptide repeats 3, Interferon-induced protein with tetratricopeptide repeats 4Interferon-induced 60 kDa protein, IRG2, ISG60, ISG-60, RIG-GCIG49
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: IFIT3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
• Quantity: 25 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 3437
• Target Species: Human
• Isotype: IgG

For Research Use Only