Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IGHMBP2 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen IGHMBP2
Immunogen Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2) The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB16901120 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16892120UL
20ul Each for $149.00
Add to cart
 
NBP168921 View Documents Novus BiologicalsSupplier Diversity Partner
NBP168921
100 ul Each for $329.00
Add to cart
 
Description

Description

IGHMBP2 Polyclonal antibody specifically detects IGHMBP2 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.
Specifications

Specifications

IGHMBP2
Rabbit
Polyclonal
Unconjugated
3508
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2) The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL.
Primary
IgG
ATP-dependent helicase IGHMBP2, CATF1FLJ41171, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, GF-1, Glial factor 1, HCSA, HMN6cardiac transcription factor 1, immunoglobulin mu binding protein 2, Immunoglobulin mu-binding protein 2, SMARD1DNA-binding protein SMUBP-2, SMBP2, SMUBP2FLJ34220
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit