Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-10R alpha Antibody, Novus Biologicals™
SDP

Catalog No. NB236045 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB236045 100 μg
NB239029 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB236045 Supplier Novus Biologicals Supplier No. NBP321308100UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

IL-10R alpha Polyclonal antibody specifically detects IL-10R alpha in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen IL-10R alpha
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CD210 antigen, CDw210a, HIL-10R, IBD28, IL-10 receptor subunit alpha, IL-10R subunit 1, IL-10R1, IL-10RA, IL10RIL-10R subunit alpha, interleukin 10 receptor, alpha, interleukin-10 receptor alpha chain, Interleukin-10 receptor subunit 1, interleukin-10 receptor subunit alpha
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 3587
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.