Learn More
IL-17RA/IL-17R Rabbit anti-Mouse, Rat, Clone: 6Q2U9, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | IL-17RA/IL-17R |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 6Q2U9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CD217, CD217 antigen, CDw217interleukin 17 receptor, hIL-17R, IL-17 receptor A, IL-17RAMGC10262, IL17Rinterleukin-17 receptor A, interleukin 17 receptor A |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 767-866 of human IL-17RA/IL-17R (Q96F46). GCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.