Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-7R alpha/CD127 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32131325UL
Description
IL-7R alpha/CD127 Polyclonal antibody specifically detects IL-7R alpha/CD127 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
IL-7R alpha/CD127 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
CD127 antigen, CD127ILRA, CDW127, IL-7 receptor subunit alpha, IL-7R subunit alpha, IL7RA, IL-7RA, IL-7R-alpha, interleukin 7 receptor, interleukin 7 receptor alpha chain, interleukin 7 receptor isoform H5-6, interleukin-7 receptor subunit alpha | |
This antibody was developed against Recombinant Protein corresponding to amino acids: HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES | |
25 μg | |
Apoptosis, Cytokine Research, Immunology, Innate Immunity, Phospho Specific | |
3575 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction