INMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155015

Catalog No. NBP155015

Description

INMT Polyclonal specifically detects INMT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: INMT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Amine N-methyltransferase, Aromatic alkylamine N-methyltransferase, Arylamine N-methyltransferase, EC 2.1.1, EC 2.1.1.49, Indolamine N-methyltransferase, indolethylamine N-methyltransferase, MGC125940, MGC125941, nicotine N-methyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95050
• Gene Symbols: INMT
• Immunogen: Synthetic peptides corresponding to INMT(indolethylamine N-methyltransferase) The peptide sequence was selected from the N terminal of INMT (NP_006765). Peptide sequence KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11185
• Target Species: Human, Rabbit
• Isotype: IgG