ISG20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157213

Catalog No. NBP157213

Description

ISG20 Polyclonal specifically detects ISG20 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ISG20
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CD25, Estrogen-regulated transcript 45 protein, HEM45EC 3.1.13.1, interferon stimulated exonuclease gene 20kDa, interferon stimulated gene (20kD), interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3669
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96AZ6
• Gene Symbols: ISG20
• Immunogen: Synthetic peptides corresponding to ISG20(interferon stimulated exonuclease gene 20kDa) The peptide sequence was selected from the middle region of ISG20. Peptide sequence TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Equine: 85%; Bovine: 78%.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG