Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ISG20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15721320UL
Description
ISG20 Polyclonal specifically detects ISG20 in Human samples. It is validated for Western Blot.Specifications
ISG20 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96AZ6 | |
ISG20 | |
Synthetic peptides corresponding to ISG20(interferon stimulated exonuclease gene 20kDa) The peptide sequence was selected from the middle region of ISG20. Peptide sequence TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
CD25, Estrogen-regulated transcript 45 protein, HEM45EC 3.1.13.1, interferon stimulated exonuclease gene 20kDa, interferon stimulated gene (20kD), interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20 | |
Rabbit | |
Affinity Purified | |
RUO | |
3669 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction