Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ISG20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	ISG20
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15721320 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15721320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP157213 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157213	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ISG20 Polyclonal specifically detects ISG20 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ISG20
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q96AZ6
Gene ID (Entrez)	3669
Immunogen	Synthetic peptides corresponding to ISG20(interferon stimulated exonuclease gene 20kDa) The peptide sequence was selected from the middle region of ISG20. Peptide sequence TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	CD25, Estrogen-regulated transcript 45 protein, HEM45EC 3.1.13.1, interferon stimulated exonuclease gene 20kDa, interferon stimulated gene (20kD), interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20
Gene Symbols	ISG20
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ISG20 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents