Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ISG20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ISG20 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15721320
|
Novus Biologicals
NBP15721320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157213
|
Novus Biologicals
NBP157213 |
100 μL |
Each for $487.50
|
|
|||||
Description
ISG20 Polyclonal specifically detects ISG20 in Human samples. It is validated for Western Blot.Specifications
| ISG20 | |
| Polyclonal | |
| Rabbit | |
| Q96AZ6 | |
| 3669 | |
| Synthetic peptides corresponding to ISG20(interferon stimulated exonuclease gene 20kDa) The peptide sequence was selected from the middle region of ISG20. Peptide sequence TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CD25, Estrogen-regulated transcript 45 protein, HEM45EC 3.1.13.1, interferon stimulated exonuclease gene 20kDa, interferon stimulated gene (20kD), interferon-stimulated gene 20 kDa protein, Promyelocytic leukemia nuclear body-associated protein ISG20 | |
| ISG20 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title