Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ISLR-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24951525UL
Description
ISLR-2 Polyclonal antibody specifically detects ISLR-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
ISLR-2 | |
Polyclonal | |
Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
immunoglobulin superfamily containing leucine-rich repeat 2, KIAA1465, leucine-rich repeat domain and immunoglobulin domain-containing axon extension protein, LINX, UNQ1885/PRO4329 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYR | |
25 μL | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
57611 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction