Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IWS1 Antibody, Novus Biologicals™
SDP

Catalog No. p-200057666 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395728 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395728 Supplier Novus Biologicals Supplier No. NBP24934925UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

IWS1 Polyclonal antibody specifically detects IWS1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen IWS1
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias DKFZp761G0123, FLJ14655, interacts with Spt6, IWS1 homolog (S. cerevisiae), protein IWS1 homolog
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55677
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.