Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KDELR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$377.03 - $666.47
Specifications
| Antigen | KDELR2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
KDELR2 Polyclonal specifically detects KDELR2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| KDELR2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 11014 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ELP-1(Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2, ER lumen protein retaining receptor 2, ERD2.2FLJ45532, ERD-2-like protein, ERD2-like protein 1, KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2, KDEL endoplasmic reticulum protein retention receptor 2, KDEL receptor 2 | |
| KDELR2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title