Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KLHDC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

KLHDC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NBP15541920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15541920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP15541920 Supplier Novus Biologicals Supplier No. NBP15541920UL

Description

Rabbit Polyclonal Antibody

KLHDC2 Polyclonal specifically detects KLHDC2 in Human samples. It is validated for Western Blot.

Specifications

Antigen KLHDC2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y2U9
Gene Alias HCA33, HCLP-1Host cell factor-like protein 1, Hepatocellular carcinoma-associated antigen 33, Host cell factor homolog LCP, kelch domain containing 2, kelch domain-containing protein 2, LCP
Gene Symbols KLHDC2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KLHDC2(kelch domain containing 2) The peptide sequence was selected from the N terminal of KLHDC2. Peptide sequence VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV.
Molecular Weight of Antigen 46 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23588
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.