Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15541920UL
Description
KLHDC2 Polyclonal specifically detects KLHDC2 in Human samples. It is validated for Western Blot.Specifications
KLHDC2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9Y2U9 | |
KLHDC2 | |
Synthetic peptides corresponding to KLHDC2(kelch domain containing 2) The peptide sequence was selected from the N terminal of KLHDC2. Peptide sequence VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV. | |
Affinity Purified | |
RUO | |
23588 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HCA33, HCLP-1Host cell factor-like protein 1, Hepatocellular carcinoma-associated antigen 33, Host cell factor homolog LCP, kelch domain containing 2, kelch domain-containing protein 2, LCP | |
Rabbit | |
46 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction