KLHL31 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170594

Catalog No. NBP170594

Description

KLHL31 Polyclonal specifically detects KLHL31 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KLHL31
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: KLHL31
• Immunogen: Synthetic peptides corresponding to KLHL31(kelch-like 31 (Drosophila)) The peptide sequence was selected from the C terminal of KLHL31. Peptide sequence TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 401265
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: bA345L23.2, BKLHD6, BTB and kelch domain-containing protein 6, KBTBD1, kelch repeat and BTB (POZ) domain containing 1, kelch repeat and BTB domain-containing protein 1, kelch-like 31 (Drosophila), kelch-like protein 31, kelch-like protein KLHL, KLHL
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.