Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KLHL31 Antibody, Novus Biologicals™

KLHL31 Antibody, Novus Biologicals™
SDP

Catalog No. p-7110737 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP170594 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP170594 Supplier Novus Biologicals Supplier No. NBP170594
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

KLHL31 Polyclonal specifically detects KLHL31 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen KLHL31
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias bA345L23.2, BKLHD6, BTB and kelch domain-containing protein 6, KBTBD1, kelch repeat and BTB (POZ) domain containing 1, kelch repeat and BTB domain-containing protein 1, kelch-like 31 (Drosophila), kelch-like protein 31, kelch-like protein KLHL, KLHL
Gene Symbols KLHL31
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KLHL31(kelch-like 31 (Drosophila)) The peptide sequence was selected from the C terminal of KLHL31. Peptide sequence TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP.
Molecular Weight of Antigen 70 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 401265
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.