Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Klotho beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309315100UL
Description
Klotho beta Polyclonal specifically detects Klotho beta in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| Klotho beta | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| beta-klotho, betaKlotho, BKL, klotho beta, klotho beta like, klotho beta-like protein, MGC142213 | |
| The immunogen is a synthetic peptide directed towards the middle region of human Klotho beta (NP_783864). Peptide sequence DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 152831 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction