Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KRAS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23357925UL
Description
KRAS Polyclonal specifically detects KRAS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
KRAS | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
P01116 | |
KRAS | |
This antibody was developed against a recombinant protein corresponding to amino acids: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV | |
25 μL | |
Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Stem Cell Markers | |
3845 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
cellular c-Ki-ras2 proto-oncogene, c-Ki-ras, C-K-RAS, GTPase KRas, Ki-Ras, Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog, K-Ras 2, K-ras p21 protein, KRAS1, K-RAS2A, K-RAS2B, KRAS2NS3, K-RAS4A, K-RAS4B, NS, oncogene KRAS2, PR310 c-K-ras oncogene, RASK2c-Kirsten-ras protein, transforming protein p21, v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction