KRAS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436831	Novus Biologicals NBP23357925UL	25 μL
NBP233579	Novus Biologicals NBP233579	0.1 mL

Description

KRAS Polyclonal specifically detects KRAS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KRAS
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P01116
• Gene ID (Entrez): 3845
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: cellular c-Ki-ras2 proto-oncogene, c-Ki-ras, C-K-RAS, GTPase KRas, Ki-Ras, Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog, K-Ras 2, K-ras p21 protein, KRAS1, K-RAS2A, K-RAS2B, KRAS2NS3, K-RAS4A, K-RAS4B, NS, oncogene KRAS2, PR310 c-K-ras oncogene, RASK2c-Kirsten-ras protein, transforming protein p21, v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
• Gene Symbols: KRAS
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only