Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LARGE Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | LARGE |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LARGE Polyclonal specifically detects LARGE in Human samples. It is validated for Western Blot.Specifications
| LARGE | |
| Polyclonal | |
| Rabbit | |
| O95461 | |
| 9215 | |
| Synthetic peptides corresponding to LARGE(like-glycosyltransferase) The peptide sequence was selected from the middle region of LARGE (NP_004728). Peptide sequence AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Acetylglucosaminyltransferase-like 1A, EC 2.4, glycosyltransferase-like protein LARGE1, KIAA0609acetylglucosaminyltransferase-like protein, LARGE1, like-acetylglucosaminyltransferase, like-glycosyltransferase, MDC1D, MDDGA6, MDDGB6 | |
| LARGE | |
| IgG | |
| 88 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title