Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC37A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | LRRC37A3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19147420
|
Novus Biologicals
NBP19147420UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP191474
|
Novus Biologicals
NBP191474 |
100 μL |
Each for $482.50
|
|
|||||
Description
LRRC37A3 Polyclonal specifically detects LRRC37A3 in Human samples. It is validated for Western Blot.Specifications
| LRRC37A3 | |
| Polyclonal | |
| Rabbit | |
| NP_955372 | |
| 374819 | |
| Synthetic peptide directed towards the middle region of human LRRC37A3. Peptide sequence NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ34306, KIAA0563, leucine rich repeat containing 37, member A3, leucine-rich repeat-containing protein 37A3, LRRC37A, MGC41826, MGC57168 | |
| LRRC37A3 | |
| IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title