Map17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18429025UL

Catalog No. NB432713

Description

Map17 Polyclonal specifically detects Map17 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Map17
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: 17 kDa membrane-associated protein, DD96, MAP17epithelial protein up-regulated in carcinoma, membrane associated protein 17, membrane-associated protein 17, PDZK1 interacting protein 1, PDZK1-interacting protein 1, Protein DD96, RP1-18D14.5, SPAP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PDZK1IP1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST
• Quantity: 25 μL
• Research Discipline: Cancer, Lipid and Metabolism
• Gene ID (Entrez): 10158
• Target Species: Human
• Isotype: IgG

For Research Use Only