Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19163725UL
Description
44256 Polyclonal specifically detects 44256 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MARCH1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q8TCQ1 | |
| 43160 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| E3 ubiquitin-protein ligase MARCH1, EC 6.3.2, EC 6.3.2.-, MARCH-IDKFZp564M1682, membrane-associated ring finger (C3HC4) 1, Membrane-associated RING finger protein 1, Membrane-associated RING-CH protein I, RING finger protein 171, RNF171FLJ20668 | |
| Rabbit | |
| 32 kDa | |
| 25 μL | |
| Zinc Finger | |
| 55016 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction