Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MASA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | MASA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155361
|
Novus Biologicals
NBP155361 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP1553620
|
Novus Biologicals
NBP15536120UL |
20 μL | N/A | N/A | N/A | ||||
Description
MASA Polyclonal specifically detects MASA in Human samples. It is validated for Western Blot.Specifications
| MASA | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| acireductone synthase, DKFZp586M0524, E1, EC 3.1.3.77, enolase-phosphatase 1, enolase-phosphatase E1, MASA homolog, MASAFLJ12594, MST1452,3-diketo-5-methylthio-1-phosphopentane phosphatase | |
| ENOPH1 | |
| IgG | |
| 29 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UHY7 | |
| 58478 | |
| Synthetic peptides corresponding to ENOPH1(enolase-phosphatase 1) Antibody(against the N terminal of ENOPH1. Peptide sequence IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title