Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MDMX Antibody, Novus Biologicals™
SDP

Catalog No. NB393272 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393272 25 μL
NBP258791 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393272 Supplier Novus Biologicals Supplier No. NBP25879125UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MDMX Polyclonal specifically detects MDMX in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen MDMX
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias DKFZp781B1423, double minute 4 homolog, Double minute 4 protein, double minute 4, human homolog of; p53-binding protein, HDMX, Mdm2-like p53-binding protein, Mdm4 p53 binding protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 4, p53 binding protein, Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse), MDM4-related protein 1, MDMXMGC132766, mouse double minute 4, human homolog of; p53-binding protein, MRP1, p53-binding protein Mdm4, protein Mdm4, Protein Mdmx
Gene Symbols MDM4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, DNA Repair, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4194
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.