MDMX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258791

Catalog No. NBP258791

Description

MDMX Polyclonal specifically detects MDMX in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MDMX
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZp781B1423, double minute 4 homolog, Double minute 4 protein, double minute 4, human homolog of; p53-binding protein, HDMX, Mdm2-like p53-binding protein, Mdm4 p53 binding protein homolog (mouse), Mdm4, transformed 3T3 cell double minute 4, p53 binding protein, Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse), MDM4-related protein 1, MDMXMGC132766, mouse double minute 4, human homolog of; p53-binding protein, MRP1, p53-binding protein Mdm4, protein Mdm4, Protein Mdmx
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MDM4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENS
• Quantity: 100 μL
• Research Discipline: Apoptosis, DNA Repair, Signal Transduction
• Gene ID (Entrez): 4194
• Target Species: Human
• Isotype: IgG

For Research Use Only