Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Melanoma antigen family C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP16896120UL

View more versions of this product

Catalog No. NBP1689620

$206.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

Melanoma antigen family C2 Polyclonal specifically detects Melanoma antigen family C2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Melanoma antigen family C2
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Accession No.	Q9UBF1
Gene Symbols	MAGEC2
Immunogen	Synthetic peptides corresponding to MAGEC2 (melanoma antigen family C, 2) The peptide sequence was selected from the N terminal of MAGEC2. Peptide sequence SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF.
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	51438
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	Cancer/testis antigen 10, CT10MAGE-E1 antigen, HCA587MAGE-C2, hepatocellular cancer antigen 587, Hepatocellular carcinoma-associated antigen 587, MAGE-C2 antigen, MAGEE1MGC13377, melanoma antigen family C, 2, melanoma antigen, family E, 1, cancer/testis specific, melanoma-associated antigen C2
Host Species	Rabbit
Molecular Weight of Antigen	41 kDa
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Melanoma antigen family C2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions