Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Melanoma antigen family C2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Melanoma antigen family C2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1689620
|
Novus Biologicals
NBP16896120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP168961
|
Novus Biologicals
NBP168961 |
100 μL |
Each for $487.50
|
|
|||||
Description
Melanoma antigen family C2 Polyclonal specifically detects Melanoma antigen family C2 in Human samples. It is validated for Western Blot.Specifications
| Melanoma antigen family C2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Cancer/testis antigen 10, CT10MAGE-E1 antigen, HCA587MAGE-C2, hepatocellular cancer antigen 587, Hepatocellular carcinoma-associated antigen 587, MAGE-C2 antigen, MAGEE1MGC13377, melanoma antigen family C, 2, melanoma antigen, family E, 1, cancer/testis specific, melanoma-associated antigen C2 | |
| MAGEC2 | |
| IgG | |
| 41 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UBF1 | |
| 51438 | |
| Synthetic peptides corresponding to MAGEC2 (melanoma antigen family C, 2) The peptide sequence was selected from the N terminal of MAGEC2. Peptide sequence SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title